PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma140g00280.1
Common NameZOSMA_140G00280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family EIL
Protein Properties Length: 513aa    MW: 58834.6 Da    PI: 9.7966
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma140g00280.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3430.12.2e-13133492354
                       XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                        l +rm  d+m+lkr+ke  +++       tg+ + ++s++qarrkkmsraQDgiL+YM+k+mev++aqGfvYgiipekgkpv+gas +LraW
  Zosma140g00280.1   3 QLRQRMRNDRMRLKRIKEHYRNK-------TGNDTRRQSKDQARRKKMSRAQDGILRYMFKMMEVYKAQGFVYGIIPEKGKPVSGASHNLRAW 88 
                       5889**********999999985.......46677799******************************************************* PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT-- CS
              EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgls 187
                       Wk+ v+fdrngpaais++ + n +++ +++ ++  ss+sh l++lqDTtlgSLLsalmqhcdppqrr+plekgv+pPWWP G+e ww++lg+s
  Zosma140g00280.1  89 WKDRVRFDRNGPAAISNHHSVNSVPGINEDINS-DSSTSHVLQDLQDTTLGSLLSALMQHCDPPQRRYPLEKGVAPPWWPRGNEHWWPQLGIS 180
                       **************************9999988.9********************************************************** PP

                       TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXX CS
              EIN3 188 kdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtls 277
                       kd+ +ppykkphdlkk wkv+vLtavikhm p+i++i++l rqsk+lqdkm+ake +++ls++nq e +c+   ++++   s++++ +++ ++
  Zosma140g00280.1 181 KDHPPPPYKKPHDLKKIWKVAVLTAVIKHMLPDIAKIQKLTRQSKCLQDKMTAKENATWLSIINQHEILCH---PQPPtlfSFSSSTNQYDVQ 270
                       ********************************************************************994...4443222444444444444 PP

                       XXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXX...XXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
              EIN3 278 ceqkedvegkkeskikhvqavkttagfpvvrkrkkkps...esakvsskevsrtcqssqfrgsetelifadknsisqney 354
                        +++     +++s     ++++  +  ++++kr    +   e++  +s+++++tc++  +++++ +l+f d+ns+++++y
  Zosma140g00280.1 271 ASHE-PIAIDNRSMELRFRKDECDEPSELIKKRGGGVKvdlEPSLNNSHNTCYTCENILCPYHDRRLGFVDMNSRNNHQY 349
                       4432.3346666665667777777789999999854332126777888899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.6E-1173246No hitNo description
Gene3DG3DSA:1.10.3180.103.9E-68121250IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.68E-58126249IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MDQLRQRMRN DRMRLKRIKE HYRNKTGNDT RRQSKDQARR KKMSRAQDGI LRYMFKMMEV  60
YKAQGFVYGI IPEKGKPVSG ASHNLRAWWK DRVRFDRNGP AAISNHHSVN SVPGINEDIN  120
SDSSTSHVLQ DLQDTTLGSL LSALMQHCDP PQRRYPLEKG VAPPWWPRGN EHWWPQLGIS  180
KDHPPPPYKK PHDLKKIWKV AVLTAVIKHM LPDIAKIQKL TRQSKCLQDK MTAKENATWL  240
SIINQHEILC HPQPPTLFSF SSSTNQYDVQ ASHEPIAIDN RSMELRFRKD ECDEPSELIK  300
KRGGGVKVDL EPSLNNSHNT CYTCENILCP YHDRRLGFVD MNSRNNHQYD CKYNNNIVNG  360
FSQGMNMIGM RGFSGFQQHK PNERKPLYTN PNVLGLGIGG DGPRAIDNLM AFCENNRVVN  420
MMEKPRVRMD DNFFGASGGM FEEIIANSSN NNNAIHLQYE NNQNTSDVNG GADFRFGSSS  480
FTNFSSSPKQ EAWSLWRAGK QECSKWMLDR LN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-701242551132Protein ETHYLENE INSENSITIVE 3
4zds_B1e-701242551132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243659.11e-159PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246061e-141EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0K9Q0020.0A0A0K9Q002_Z
STRINGVIT_13s0047g00250.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-129EIL family protein